AnaSpec introduces 55 new catalogue peptides

Peptides/Amyloid Peptides.

Beta-Amyloid (1-15) (Cat# 61798).

Sequence: DAEFRHDSGYEVHHQ.

Sequence (3-Letter): H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-OH.

Beta-Amyloid (7-22) (Cat# 61803).

This beta Amyloid 7 to 22 amino acid residues peptide was utilized in studies of the catabolism of the b-amyloid peptides.

This peptide contains several potential iodination sites.

Sequence: DSGYEVHHQKLVFFAE.

Sequence (3-Letter): H-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-OH.

Reference(s): Ghiso, J et al J Biol Chem 279, 45897 (2004).

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-01).

Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV.

Sequence (3-Letter):.

Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val.

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-05).

Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV.

Sequence (3-Letter):.

Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val.

Biotin-LC-beta-Amyloid(1-40), mouse, rat (Cat# 61717-1).

Sequence: Biotin-LC-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV.

Sequence (3-Letter):.

Biotin-LC-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val.

Beta-Amyloid (1-34) (Cat# 61799).

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL.

Sequence (3-Letter):.

H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-OH.

Peptides/Bacterial Peptides.

P69 (522-534), M leprae (Cat# 61688).

A Mycobacteria leprae heat shock protein (M leprae HSP65)-specific epitope.

This peptide is recognized by M leprae HSP65-reactive CD4+ T-cell clones.

Sequence: PEKTAAPASDPTG.

Sequence (3-Letter): H-Pro-Glu-Lys-Thr-Ala-Ala-Pro-Ala-Ser-Asp-Pro-Thr-Gly-OH.

Reference(s): Mustafa, A et al Infect Immun 67, 5683 (1999).

Peptides/Ghrelin Peptides.

Biotin-Ghrelin, bovine (Cat# 61714).

This is a biotinylated form of the bovine grhelin peptide.

The octanoyl modification at Ser3 (n-octanoyl Ghrelin) is the major active form of ghrelin.

Ghrelin is a peptide hormone produced by the stomach in mammals, but also detectable in many other tissues.

Endogenous Ghrelin participates in the regulation of food intake, body weight, energy homeostasis, it is an endogenous ligand for the growth hormone secretagogue receptor (GHS-R) and is involved in the release of growth hormone from the anterior pituitary.

Sequence: GS-S(n-octanoylated)-FLSPEHQKLQRKEAKKPSGRLKPR.

Sequence (3-Letter):.

H-Gly-Ser-Ser(n-octanoylated)-Phe-Leu-Ser-Pro-Glu-His-Gln-Lys-Leu-Gln-Arg-Lys-Glu-Ala-Lys-Lys-Pro-Ser-Gly-Arg-Leu-Lys-Pro-Arg-OH.

Reference(s): ThidarMyint, H et al J Endocrinol 189, 655 (2006); Gauna, C et al J Clin Endo Metab 90, 1055 (2005); Currie, P et al Am J Physiol Regul Integr Comp Physiol 289, R353 (2005); Arvat, E et al J Clin Endo Metab 86, 1169 (2001).

Peptides/Protein Phosphorylation Related Peptides.

(pS8, pS13) Eucariotic Translation Initiation Factor 2B, eIF2B (Cat# 61739).

This is an eukaryotic protein synthesis initiation factor 2B (elF2B), the double phosphorylated amidated peptide.

Dephosphorylation of this peptide by insulin signaling and glycogen synthase kinase 3 (GSK3) inhibition leads to its activation.

The references below correspond to the single phosphorylated peptide.

Sequence: RRAAEELDpSRAGpSPQL.

Sequence (3-Letter): H-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-pSer-Arg-Ala-Gly-pSer-Pro-Gln-Leu-OH.

Reference(s): Frame, S et al Mol Cell 7, 1321 (2001); Orena, S et al J Biol Chem 275, 15765 (2000); Kang Ho Kim, et al J Biol Chem 279, 51999 (2004); Niloulina, S et al Diabetes 51, 2190 (2002); Brady, M et al J Biol Chem 273, 14063 (1998).

Gycogen Synthase-derived peptide, phosphorylated, Tamra-labeled (Cat# 61725).

A Tamra-labeled phosphorylated Glycogen synthese derived peptide (Ab/Em = 544/572 nm).

This peptide, which is phosphorylated at the serine residue and obtained from the N terminal of Glycogen synthase protein sequence, is a substrate for MAPKAPK2 (Mitogen activated protein kinase).

Sequence: 5-Tamra-KKLNRTL-pS-VA-OH.

Sequence (3-Letter): 5-Tamra-Phe-Phe-Leu-Asn-Arg-Thr-Leu-pSer-Val-Ala-OH.

Reference(s): Stokoe, D et al Biochem J 296, 846 (1993).

Histone H1-derived peptide, FAM-labeled (Cat# 61762).

This is a FAM-labeled Histone H1-derived peptide (Ab/Em = 494/521 nm).

Histone H1-derived peptide phosphorylated by protein kinase A is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.

Sequence: 5-FAM-GGGPATPKKAKKL-OH.

Sequence (3-Letter): 5-FAM-Gly-Gly-Gly-Pro-Ala-Thr-Pro-lys-lys-Ala-Lys-Lys-Leu-OH.

Reference(s): Pomerant, A et al Proc Natl Acad Sci USA 74, 4261 (1977).

Cdc25C-derived peptide (Cat# 61726).

This peptide is used as a substrate for CHK (checkpoint kinase) 1 and 2 in in-vitro kiase assays.

Sequence: 5-FAM-VSRSGLYRSPSMPENLNRPR-OH.

Sequence (3-Letter): 5-FAM-Val-Ser-Arg-Ser-Gly-Leu-Tyr-Arg-Ser-Pro-Ser-Met-Pro-Glu-Asn-Leu-Asn-Arg-Pro-Arg-OH.

Reference(s): O'Neill, T et al Biol Chem 277, 16102 (2002).

EGFR-derived peptide (Cat# 61790).

This EGFR derived peptide is a potential substrate for EGFR (Epidermal Growth Factor Receptor) protein tyrosine kinase.

Sequence: LVEPLTPSGEAPNQK-OH.

Sequence (3-Letter): H-Leu-Val-Glu-Pro-Leu-Thr-Pro-Ser-Gly-Glu-Ala--Pro-Asn--Gln-Lys-OH.

Reference(s): Bishayee, A et al Mol Biol Cell 10, 671 (1995).

CK1tide (Cat# 61767).

CK1tide is obtained from inhibitor-2 of protein phosphatase-1 with modifications that makes it a good substrate for casein kinase I ( Km = 172 uM but a poor substrate for casein kinase II.

Sequence: HAAIGDDDDAYSITS-NH2.

Sequence (3-Letter): H-His-Ala-Ala-Ile-Gly-Asp-Asp-Asp-Asp-Ala-Tyr-Ser-Ile-Thr-Ser-NH2.

Reference(s): Marin, O et al Biochem Biophys Res Commun 198, 898 (1994).

PLM derived peptide (Cat# 61780).

PLM derived peptide is a substrate for PKC (protein kinase C), with insulin induced phosphorylation in skeletal muscle in-situ ocurring at Ser-63 and Ser-68.

Synthetic PLM(58-72) can serve as an inhibitor of PLM phosphorylation.

Sequence: IRRLSTRRR-OH.

Sequence (3-Letter): H-Ile-Arg-Arg-Leu-Ser-Thr-Arg-Arg-Arg-OH.

Reference(s): Matsudaira, P et al J Biol Chem 262, 11955 (1987) ADR1-derived peptide (Cat# 61784).

ADR1 derived peptide is a substrate for cAMP dependent protein kinase and for two members of the CaM Kinase family, CaMKII and Ca2+/CaM dependent kinase 4 (CaMK IV) which regulate the synthesis of glucose-repressible isozyme of alcohol dehydrogenase.

Sequence: LKKLTRRASFSGQ-OH.

Sequence (3-Letter): H-Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln-OH.

Reference(s): Kemp, B et al Protein Kinases 238, 1726 (1987).

p38tide, FAM-labeled (Cat# 61754).

A FAM-labeled p38tide (Ab/Em = 494/521 nm).

This peptide produced in Escherichia Coli, is readily phosphorylated by p38SAPK in in-vitro analysis.

Sequence: 5-FAM-IPTTPITTTYFFFK-NH2.

Sequence (3-Letter): 5-FAM-Ile-Pro-Thr-Thr-Pro-Ile-Thr-Thr-Thr-Tyr-Phe-Phe-Phr-Lys-NH2.

Reference(s): Boros, DL et al Clin Microbial Rev 2, 250 (1989).

p38tide, TAMRA-labeled (Cat# 61753).

This peptide produced in Escherichia Coli, is readily phosphorylated by p38SAPK in in-vitro analysis.

Sequence: 5-TAMRA-IPTTPITTTYFFFK-NH2.

Sequence (3-Letter): 5-TAMRA-Ile-Pro-Thr-Thr-Pro-Ile-Thr-Thr-Thr-Tyr-Phe-Phe-Phr-Lys-NH2.

Reference(s): Boros, DL et al Clin Microbial Rev 2, 250 (1989).

p38tide (Cat# 61752).

Synapsin I derived peptide is a neuron specific substrate for cAMP dependent and Ca2+/calmodulin dependent protein kinase.

It plays an important role in the mechanism involved in neuron transmitter disease and regulates the availability of synaptic vesicles for exocytosis.

Sequence: LRRRLSDANF-NH2.

Sequence (3-Letter): H-Leu-Arg-Arg-Arg-leu-Ser-Asp-Ala-Asn--Phe-NH2.

Reference(s): Bahler, M et al J Neurochem 73, 921 (1999).

CDK7tide derived peptide, FAM-labeled (Cat# 61760).

This is a FAM-labeled CDK7derived peptide (Ab/Em = 494/521 nm).

CDK7 derived peptide can be used as a substrate for CDK7(cyclin dependent protein kinase), the catalytic subunit of the CDK activating kinase (CAK) complex.

Sequence: 5-FAM-FLAKSFGSPNRAYKK-OH.

Sequence (3-Letter): 5-FAM-Phe-Leu-Ala-Lys-Ser-Phe-Gly-Ser-Pro-Asn-Arg-Ala-Tyr-Lys-Lys-OH.

Reference(s): Akoulitchev, S et al Genes Dev 12, 3541 (1998).

Abltide (Cat# 61749).

This is a FAM-labeled Abltide (Ab/Em = 494/521 nm).

Abltide is a peptide substrate for Abl Kinase (Abl protein tyrosine kinase), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus.

Used in Western blot and kinase assay.

Sequence: KKGEAIYAAPFA-NH2.

Sequence (3-Letter): Lys-Lys-Gly-Glu-Ala-Ile-Tyr-Ala-Ala-Pro-Phe-Ala-NH2.

Reference(s): Reddy, P et al Proc Natl Acad Sci USA 80, 3623 (1983).

ADR1-derived peptide, FAM-labeled (Cat# 61783).

This is a FAM-labeled ADR1 derived peptide (Ab/Em = 494/521 nm).

ADR1 derived peptide is a substrate for cAMP dependent protein kinase and for two members of the CaM Kinase family, CaMKII and Ca2+/CaM dependent kinase 4 (CaMK IV) which regulates the synthesis of glucose-repressible isozyme of alcohol dehydrogenase.

Sequence: 5-FAM-LKKLTRRASFSGQ-OH.

Sequence (3-Letter): 5-FAM-Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln-OH.

Reference(s): Kemp, B et al Protein Kinases 238, 1726 (1987).

IP3R-derived peptide (Cat# 61730).

IP3R derived peptide obtained from the sequence in the inositol 1,4,5-triohosphate receptor (IP3R).

It is phosphorylated on the same serine residue in vitro by both cGKI and cAK(51).

Sequence: GRRESLTSFG-NH2.

Sequence (3-Letter): Gly-Arg-Arg-Glu-Ser-Leu-Thr-Ser-Phe-Gly-NH2.

Reference(s): Kuo, JF et al J Biol.

Chem 245, 2493 (1970).

Synapsin I-derived peptide (Cat# 61755).

Synapsin I derived peptide is a neuron specific substrate for cAMP dependent and Ca2+/calmodulin dependent protein kinase.

It plays an important role in neurotransmitter disease.

It regulates the availability of synaptic vesicles for exocytosis.

Sequence: LRRRLSDANF-NH2.

Sequence (3-Letter): leu-Arg-Arg-Arg-leu-Ser-Asp-Ala-Asn--Phe-NH2.

Reference(s): Bahler, M et al J Neurochem 73, 921 (1999).

AMPKtide (Cat# 61747).

AMPKtide can be used as a substrate for 5'-AMP activated protein kinase (AMPK) in in-vitro kinase assays and is phosphorylated by AMPK with a Km of 33.3microM and a Vmax of 8.1 micromol/min/mg.

Sequence: 5-FAM-LKKLTRRASFSAQ.

Sequence (3-Letter): Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln-OH.

Reference(s): Michelle, B et al J Biol Chem 99, 16899 (1999).

CREBtide (Cat# 61770).

CREBtide is a substrate for PKA (Protein kinase).

Sequence: GEILSRRPSYRK-NH2.

Sequence (3-Letter): Gly-Glu-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-Lys-NH2.

Reference(s): Bok, J et al, J NeuroSci Biol 23, 777 (2003) PLM derived peptide, TAMRA-labeled (Cat# 61779).

This is a Tamra-labeled PLM derived peptide (Ab/Em = 544/574 nm).

PLM derived peptide is a substrate for PKC(protein kinase C), with insulin induces phosphorylation in skeletal muscle in-situ ocurring at Ser-63 and Ser-68.

Synthetic PLM(58-72) can serve as an inhibitor of PLM phosphorylation.

Sequence: 5-Tamra-IRRLSTRRR-OH.

Sequence (3-Letter): 5-Tamra-Ile-Arg-Arg-Leu-Ser-Thr-Arg-Arg-Arg-OH.

Reference(s): Matsudaira, P et al J Biol Chem 262, 11955 (1987).

Synapsin I-derived peptide, Tamra-labeled (Cat# 61757).

This is a Tamra-labeled Synapsin I derived peptide (Ab/Em = 544/574 nm).

Synapsin I derived peptide is a neuron specific substrate for cAMP dependent and Ca2+/calmodulin dependent protein kinase and plays an important role in the mechanism involved in neuron transmitter disease.

It regulates the availability of synaptic vesicles for exocytosis.

Sequence: 5-Tamra-LRRRLSDANF-NH2.

Sequence (3-Letter): 5-TAMRA-leu-Arg-Arg-Arg-leu-Ser-Asp-Ala-Asn--Phe-NH2.

Reference(s): Bahler, M et al J Neurochem 73, 921 (1999).

Erktide, FAM-labeled (Cat# 61778).

This is a FAM-labeled Erktide peptide (Ab/Em = 494/521 nm).

Erktide is a peptide substrate for ERK2 (Extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.

Sequence: IPTTPITTTYFFF-K (5-FAM)-OH.

Sequence (3-Letter): H-Ile-Pro-Thr-Thr-Pro-Ile-Thr-Thr-Thr-Tyr-Phe-Phe-Phe-Lys (5-FAM)-OH.

Reference(s): Prowse, CN et al Biochem 39, 6258 (2000).

CDc25C-derived peptide, FAM-labeled (Cat# 61727).

A FAM-labeled Cdc25C derived peptide (Ab/Em = 494/521 nm).

This peptide is used as a substrate for CHK (checkpoint kinase) 1 and 2 in in-vitro kiase assays.

Sequence: VSRSGLYRSPSMPENLNRPR-OH.

Sequence (3-Letter): 5-FAM-Val-Ser-Arg-Ser-Gly-Leu-Tyr-Arg-Ser-Pro-Ser-Met-Pro-Glu-Asn-Leu-Asn-Arg-Pro-Arg-OH.

Reference(s): O'Neill, T et al J Biol Chem 277, 16102 (2002).

Glycogen Synthase derived peptide, FAM-labeled (Cat# 61786).

This is a FAM-labeled Glycogen Synthase-derived peptide (Ab/Em = 544/574 nm).

Glycogen Synthase-derived peptide obtained from the N terminal of Glycogen synthase is a substrate for MAPKAPK2 (Mitogen activated protein kinase).

Sequence: 5-FAM-KKLNRTLSVA-OH.

Sequence (3-Letter): 5-FAM-Phe-Phe-Leu-Asn-Arg-Thr-Leu-Ser-Val-Ala-OH.

Reference(s): Stokoe, D et al Biochem J 296, 846 (1993).

Gastrin derived peptide, FAM-labeled (Cat# 61746).

A FAM-labeled Gastrin derived peptide (Ab/Em = 494/521 nm).

Gastrin derived peptide is a novel mediator of proximal nutrient-induced proglucagon derived peptide secretion from the distal gut.

Sequence: 5-FAM-GPWLEEEEEAYGWMDFK-NH2.

Sequence (3-Letter): 5-FAM-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-Lys-NH2.

Reference(s): Roberge, JN et al Endocrinology 137, 2383 (1996).

Abltide, FAM-labeled (Cat# 61751).

Abltide is a peptide substrate for Abl Kinase (Abl protein tyrosine kinase,), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus.

Used in Western blot and kinase assay.

Sequence: 5-FAM-KKGEAIYAAPFA-NH2.

Sequence (3-Letter): 5-FAM-Lys-Lys-Gly-Glu-Ala-Ile-Tyr-Ala-Ala-Pro-Phe-Ala-NH2.

Reference(s): Reddy, P et al Proc Natl Acad Sci USA 80, 3623 (1983).

IRS1-derived peptide (Cat# 61764).

Sequence: KKSRGDYMTMQIG-NH2.

Sequence (3-Letter): H-Lys-Lys-Ser-Arg-Gly-Asp-Tyr-Met-Thr-Met-Gln-Ile-Gly-NH2.

AMPKtide, FAM-labeled (Cat# 61748).

This is a FAM labeled AMPKtide (Ab/Em = 494/521 nm).

AMPKtide can be used as a substrate for 5'-AMP activated protein kinase (AMPK) in in-vitro kinase assays and is phosphorylated by AMPK with a Km of 33.3microM and a Vmax of 8.1 micromol/min/mg Sequence: LKKLTRRASFSAQ.

Sequence (3-Letter): 5-FAM-Leu-Lys-Lys-Leu-Thr-Arg-Arg-Ala-Ser-Phe-Ser-Gly-Gln-OH.

Reference(s): Michelle, B et al J Biol Chem 99, 16899 (1999).

BTK derived peptide, FAM-labeled (Cat# 61729).

This is a FAM-labeled BTK derived peptide (Ab/Em = 494/521 nm).

BTK derived peptide is a substrate for Btk (Bruton's tyrosine kinase), a nonreceptor tyrosine kinase involved in precursor B (pre-B) cell receptor signal which is required for nomal B cell development.

Sequence: 5-FAM-KKVVALYDYMPMN-NH2.

Sequence (3-Letter): 5-FAM-Lys-Lys-Val-Val-Ala-Leu-Tyr-Asp-Tyr-Met-Pro-Met-Asn-NH2.

Reference(s): Kurosaki, T et al Annu Rev Immunol (1999).

Alternate Syntide, FAM-labeled (Cat# 61733).

A FAM-labeled Alternate Syntide 2 (Ab/Em = 494/521 nm).

This peptide is related to the NH2 terminal of glycogen synthase, a substrate for CAMK and is phosphorylated by DCLK (doublecortin like kinase).

Sequence: 5-FAM-PLSRTLSVSSLPGL-NH2.

Sequence (3-Letter): 5-FAM-Pro-Leu-Ser-Arg-Thr-Leu-Ser-Val-Ser-Ser-Leu-Pro-Gly-Leu-NH2.

Reference(s): Bart, M et al Mol Brain Res 120, 103 (2004).

Histone H1-derived peptide, phosphorylated (Cat# 61741).

This peptide, which is phosphorylated at threonine residue, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.

Sequence: 5-FAM-GGGPA-pT-PKKAKKL-OH.

Sequence (3-Letter): 5-FAM-Gly-Gly-Gly-Pro-Ala-pThr-Pro-lys-lys-Ala-Lys-Lys-Leu-OH.

Reference(s): Pomerant, AM et al Proc Natl Acad Sci USA 74, 4261 (1977).

p34cdc2-derived peptide, FAM-labeled (Cat# 61736).

A FAM-labeled p34cdc2-derived peptide (Ab/Em = 494/521 nm).

This peptide is a substrate for fyn like tyrosine kinase and is used to discriminate between Src like PTK activities from other PTKs.

Sequence: 5-FAM-KVEKIGEGTYGVV-NH2.

Sequence (3-Letter): 5-FAM-lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Trp-NH2.

Reference(s): Gram, H et al J Biochem 240, 633 (1997) CREBtide, FAM-labeled (Cat# 61771).

This is a FAM-labeled CREBtide (Ab/Em = 494/521 nm).CREBtide is a substrate for PKA (Protein kinase).

Sequence: 5-FAM-GEILSRRPSYRK-NH2.

Sequence (3-Letter): 5-FAM-Gly-Glu-Ile-Leu-Ser-Arg-Arg-Pro-Ser-Tyr-Arg-Lys-NH2.

Reference(s): Bok, J et al J NeuroSci Biol 23, 777 (2003).

Gycogen Synthase-derived peptide, phosphorylated (Cat# 61724).

This peptide, which is phosphorylated at the serine residue, obtained from the N terminal of the Glycogen synthase protein, is a substrate for MAPKAPK2 (Mitogen activated protein kinase).

Sequence: KKLNRTL-pS-VA-oh.

Sequence (3-Letter): Lys-Lys-Leu-Asn-Arg-Thr-Leu-pSer-Val-Ala.

Reference(s): Stokoe, D et al Biochem J 296, 846 (1993).

RS-domain derived peptide, FAM-labeled (Cat# 61723).

This is a FAM-labeled RS domain derived peptide (Ab/Em = 494/521 nm).

This peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM).

Sequence: 5-FAM-GRSRSRSRSR-OH.

Sequence (3-Letter): 5-FAM-Gly-Arg-Ser-Arg-Ser-Arg-Ser-Arg-Ser-Arg-OH.

Reference(s): Zahler, AM et al Genes Dev 6, 837 (1992).

Phosphorylated, Histone H1-derived peptide, FAM-labeled (Cat# 61742).

A FAM-labeled phospho Histone H1-derived peptide (Ab/Em = 494/521nm).

This peptide, which is phosphorylated at threonine residue, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.

Sequence: 5-FAM-GGGPA-pT-PKKAKKL-OH.

Sequence (3-Letter): 5-FAM-Gly-Gly-Gly-Pro-Ala-pThr-Pro-lys-lys-Ala-Lys-Lys-Leu-OH.

Reference(s): Pomerant, AM et al Proc Natl Acad Sci USA 74, 4261(1977).

Cathepsin D and E Substrate (Cat# 61793).

An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus).

The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.

Sequence: MOCAc-GKPILFFRLK(Dnp)-dR-NH2; Note: MOCAc is also 7-Methoxycoumarin-4-acetyl also abbreviated to Mca.

Sequence (3-Letter): 7-Methoxycoumarin-4-Acetyl-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2.

Reference(s): Yasuda, Y et al J Biochem 125, 1137 (1999).

IP3R-derived peptide, FAM-labeled (Cat# 61731).

IP3R derived peptide obtained from the sequence in the inositol 1,4,5-triohosphate receptor (IP3R).

It is phosphorylated on the same serine residue in vitro by both cGKI and cAK(51).

Sequence: 5-FAM-GRRESLTSFG-NH2.

Sequence (3-Letter): 5-FAM-Gly-Arg-Arg-Glu-Ser-Leu-Thr-Ser-Phe-Gly-NH2.

Reference(s): Kuo, JF et al J Biol Chem 245, 2493 (1970).

Synapsin I-derived peptide, FAM-labeled (Cat# 61756).

This is a FAM-labeled Synapsin I derived peptide (Ab/Em =494/521 nm).

Synapsin I derived peptide is a neuron specific substrate for cAMP dependent and Ca2+/calmodulin dependent protein kinase and plays an important role in the mechanism involved in neuron transmitter disease.

It regulates the availability of synaptic vesicles for exocytosis.

Sequence: 5-FAM-LRRRLSDANF-NH2.

Sequence (3-Letter): 5-FAM-leu-Arg-Arg-Arg-leu-Ser-Asp-Ala-Asn--Phe-NH2.

Reference(s): Bahler, M et al J Neurochem 73, 921 (1999).

p34cdc2-derived peptide, TAMRA-labeled (Cat# 61735).

A TAMRA-labeled p34cdc2-derived peptide (Ab/Em = 544/572 nm).

This peptide is a substrate for fyn like tyrosine kinase, and is used to discriminate between Src like PTK activities from other PTKs.

Sequence: 5-FAM-KVEKIGEGTYGVV-NH2.

Sequence (3-Letter): 5-FAM-lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Trp-NH2.

Reference(s): Gram, H et al J Biochem 240, 633 (1997).

Abltide, TAMRA-labeled (Cat# 61750).

This is TAMRA-labeled Abltide (Ab/Em = 544/572 nm).

Abltide is a peptide substrate for Abl Kinase (Abl protein tyrosine kinase), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus.

Used in Western blot and kinase assays.

Sequence: 5-TAMRA-KKGEAIYAAPFA-NH2.

Sequence (3-Letter): 5-TAMRA-Lys-Lys-Gly-Glu-Ala-Ile-Tyr-Ala-Ala-Pro-Phe-Ala-NH2.

Reference(s): Reddy, PE et al Proc Natl Acad Sci USA 80 (1983).

Histone H1-derived peptide, TAMRA labeled (Cat# 61763).

This is a TAMRA-labeled Histone H1-derived peptide (Ab/Em = 544/572 nm).

Histone H1-derived peptide phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.

Sequence: 5-TAMRA-GGGPATPKKAKKL-OH.

Sequence (3-Letter): 5-TAMRA-Gly-Gly-Gly-Pro-Ala-Thr-Pro-lys-lys-Ala-Lys-Lys-Leu-OH.

Reference(s): Pomerant, AM et al Proc Natl Acad Sci USA 74, 4261 (1977).

Peptides/Viral Peptides.

cDDX4 (Cat# 61439).

This is a cyclic closed-chain dodecapeptide mimicking the conformation-specific domain of CXCR4 (a molecule required for certain strains of HIV to fuse with and enter into cells), in which Gly-Asp links the amino and carboxyl termini of the decapeptidyl linear chain derived from the undecapeptidyl arch in CXCR4.

cDDX4 conjugated with a multi-antigen peptide may be a novel candidate immunogen for preventing disease progression in HIV-1-infected individuals.

The cDDX4 induced antibody inhibits the replication of HIV-1 X4 virus.

Sequence: DNVSEADDRYIG.

Sequence (3-Letter): H-Asp-Asn-Val-Ser-Glu-Ala-Asp-Asp-Arg-Tyr-Ile-Gly-OH.

Reference(s): Misumi, S et al J Biol Chem 278, 32335 (2003).

LMP1 (159-167), YLQ (Cat# 61679).

This is a LMP1 HLA-A2-restricted peptide epitope.

This epitope is located between the fifth and sixth transmembrane domain of LMP1 and is conserved between EBV strains, including the laboratory EBV strain B95-8 and virus isolates from Caucasian, African, and Southeast Asian donors.

It was used as a reference LMP1 peptide.

Sequence: YLQQNWWTL.

Sequence (3-Letter): H-Tyr-Leu-Gln-Gln-Asn-Trp-Trp-Thr-Leu-OH.

Reference(s): Gottschalk, S et al Blood 101, 1905 (2003); Duraiswamy, J et al J Virol 77, 7401 (2003); Khanna, R, et al Eur J Immunol 28, 451(1998); Khanna, R, et al J Immunol 162, 3063 (1999); Duraiswamy, J et al Cancer Res 64, 1483 (2004).

Influenza A M2 coat protein (22-46) (Cat# 61665).

This 25-residue peptide is derived from the transmembrane segment 22 to 46 of Influenza A M2 (TM-M2), a 97-residue protein that forms H+-selective ion channels.

Sequence: SSDPLVVAASIIGILHLILWILDRL.

Sequence (3-Letter): H-Ser-Ser-Asp-Pro-Leu-Val-Val-Ala-Ala-Ser-Ile-Ile-Gly-Ile-Leu-His-Leu-Ile-Leu-Trp-Ile-Leu-Asp-Arg-Leu-OH.

Reference(s): Zhong, Q et al FEBS Lett 434, 265 (1998); Torres, J and I Arkin, Biophys J 82, 1068 (2002).

Apstatin, Aminopeptidase P Inhibitor (Cat# 61832-1).

Sequence: N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-PPA-NH2.

Sequence (3-Letter): N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-Pro-Pro-Ala-NH2.

Apstatin, Aminopeptidase P Inhibitor (Cat# 61832-5).

Sequence: N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-PPA-NH2.

Sequence (3-Letter): N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-Pro-Pro-Ala-NH2.

Apstatin, Aminopeptidase P Inhibitor (Cat# 61832-25).

Sequence: N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-PPA-NH2.

Sequence (3-Letter): N-[(2S,3R)-3-amino-2-hydroxy-4-phenylbutanoyl]-Pro-Pro-Ala-NH2.

AnaSpec is a provider of proteomics to pharmaceutical, biotech, and academic research institutions throughout the world.

With a vision for innovation through synergy, AnaSpec focuses on three core technologies: peptides, detection reagents, and combinatorial chemistry.

AnaSpec carries a broad product line of biochemicals and reagents for basic research, high-throughput screening and drug discovery.

In conjunction, AnaSpec provides premier custom services including peptide synthesis, antibody production, and assay development.

Established in 1993, AnaSpec's headquarters and manufacturing facilities are located in San Jose, CA.

AnaSpec maintains ISO9001 certification, holds a California Drug Manufacturing License and a FDA Registration for GMP Drug Manufacturing.