This week AnaSpec, one of the world's largest providers of custom and catalogue peptides, introduced twenty-seven (27) new peptides for drug discovery research
Beta-amyloid (8-38) (Cat# 61879).
Sequence: SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG.
Sequence (3-Letter): H-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-OH.
Angiotensin II type 1 receptor (181-187); AT1; ATE.
(Cat# 61873).
This peptide; corresponding to the sequence of the second extracellular loop of the human Angiotensin II type 1 (AT1) receptor positions 181 to 187; contains the IgG-binding epitope for the natural AT1 receptor antibody occurring in preeclampsia and malignant hypertension.
Sequence: AFHYESQ.
Sequence (3-Letter): H-Ala-Phe-His-Tyr-Glu-Ser-Gln-OH.
AT1A; Angiotensin II receptor; (225-237) (Cat# 61902).
This peptide is a part of the cytoplasmic domain of the rat Angiotensin II (Ang II ) receptor AT1A.
AT1 receptors mediate most known functions of the multifunctional hormone Ang II.
The AT1A subtype receptor protein is localized to glomeruli; proximal and distal tubules; and collecting ducts; as well as the intrarenal vasculature.
Renal AT1A receptor protein is downregulated in Ang II - induced hypertension.
Sequence: AYEIQKNKPRNDD.
Sequence (3-Letter): H-Ala-Tyr-Glu-Ile-Gln-Lys-Asn-Lys-Pro-Arg-Asn-Asp-Asp-OH.
Galanin Like Peptide; GALP (41-60); human; porcine; rat (Cat# 61848).
Exogenously administered GALP can reverse some of the deleterious effects of diabetes on the reproductive axis and mediate the effects of leptin and insulin reproductive function.
It stimulates sexual behavior in the male rat.
Studies show the importance of hypothalamic GALP in the integration of metabolism and reproduction.
Sequence: ILDLWKAIDGLPYSRSPRMT.
Sequence (3-Letter): H-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-Arg-Ser-Pro-Arg-Met-Thr-OH.
Melanotropin-Potentiating Factor; MPF (Cat# 61856-5).
This peptide is a C-terminal tetrapeptide of human beta-lipotropin; amino acids 88 to 91.
It elicits a variety of neurotrophic effects in vivo consistent with its role in neuronal regeneration.
Sequence: KKGE.
Sequence (3-Letter): H-Lys-Lys-Gly-Glu-OH.
VA-ss-MSH; Lipotropin-?; Proopiomelanocortin-derived (Cat# 61906).
This is a novel human melanocyte-stimulating peptide hormone isolated from hemofiltrate.
It is lipolytically active in differentiated 3T3-L1 adipocytes in a dose-dependent manner in nanomolar range; and may serve some other functions in human physiology.
Sequence: VAAEKKDEGPYRMEHFRWGSPPKD.
Sequence (3-Letter): H-Val-Ala-Ala-Glu-Lys-Lys-Asp-Glu-Gly-Pro-Tyr-Arg-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp-OH.
Ac-(Leu28;31)-Neuropeptide Y (24-36) (Cat# 61936).
This Neuropeptide Y (NPY) 24 to 36 amino acids fragment is a selective NPY Y2 receptor agonist.
Sequence: Ac-LRHYLNLLTRQRY-NH2.
Sequence (3-Letter): Ac-Leu-Arg-His-Tyr-Leu-Asn-Leu-Leu-Thr-Arg-Gln-Arg-Tyr-NH2.
PAKtide (Cat# 61874).
This is a peptide substrate for the p21-activated kinase (PAK).
PAKs are the members of a family of serine/threonine protein kinases defined by their interaction with the small GTPases; Cdc42 and Rac.
Sequence: RRRLSFAEPG.
Sequence (3-Letter): H-Arg-Arg-Arg-Leu-Ser-Phe-Ala-Glu-Pro-Gly-OH.
Nuclear Export Signal; NES; PKI (Cat# 61887).
This peptide is a functional nuclear export signal (NES) of protein kinase inhibitors (PKI).
A classical NES peptide; it regulates subcellular localization and shuttling of the PKI.
Sequence: ELALKLAGLDIN.
Sequence (3-Letter): H-Glu-Leu-Ala-Leu-Lys-Leu-Ala-Gly-Leu-Asp-Ile-Asn-OH.
Histone deacetylase; HDAC substrate (Cat# 61855).
This novel fluorogenic substrate of HDACs was synthesized with an epsilon-acetylated lysyl moiety and an adjacent MCA moiety at the C-terminus of the peptide chain.
The assay utilizing this substrate provides a good tool to characterize the HDAC activity.
HDACs are important enzymes for the transcriptional regulation of gene expression.
Sequence: Ac-RGK(Ac)-AMC.
Sequence (3-Letter): Ac-Arg-Gly-Lys(Ac)-AMC.
Neuropeptide W-23; NPW23; porcine (Cat# 61852).
This 23-amino acid porcine neuropeptide W is the endogenous ligand for orphan G-protein-coupled receptors GPR7 and GPR8 expressed in the central nervous system.
It is generated from the prepropolypeptide by signal peptide cleavage and proteolytic processing at the pair of basic amino acid residues Arg56-Arg57.
Sequence: WYKHTASPRYHTVGRAAGLLMGL.
Sequence (3-Letter): H-Trp-Tyr-Lys-His-Thr-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-OH.
Neuropeptide W-30; NPW30; rat (Cat# 61870-05).
This 30-amino acid rat neuropeptide W is the endogenous ligand for orphan G-protein-coupled receptors GPR7 and GPR8 expressed in the central nervous system.
Sequence: WYKHVASPRYHTVGRASGLLMGLRRSPYLW.
Sequence (3-Letter): H-Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp-OH.
Hym-33H; Hydra nerve cell differentiation inhibitor (Cat# 61907).
Hym-33H peptide is a nerve cell differentiation signal molecule extracted from the tissue of hydra.
It inhibits nerve cell differentiation in hydra and induces tissue contraction in the planula of Hydractinia serrata.
Hydra contains a large number (>350) of peptide signal molecules involved in regulating development or other processes in cnidaria.
Sequence: AALPW.
Sequence (3-Letter): H-Ala-Ala-Leu-Pro-Trp-OH.
Hym-54; Hydra Signal Molecule (Cat# 61908).
This Hym-54 peptide is a signal molecule from hydra; a freshwater cnidarian.
Hym-54 stimulates muscle contraction in adult polyps of hydra and sea anemone; Anthopleura fuscoviridis; and induces metamorphosis of planula; the larval stage; into polyps in a marine hydrozoan species; Hydractinia serrata.
Sequence: GPMTGLW-NH2.
Sequence (3-Letter): H-Gly-Pro-Met-Thr-Gly-Leu-Trp-NH2.
NES Topoisomerase II alpha (1017-1028) (Cat# 61897).
This peptide; a nuclear export signal (NES) for Topoisomerase II alpha; supports export of topoisomerase II alpha from the nucleus to the cytoplasm.
Proteins targeted for receptor-mediated transport across the nuclear pore complexes must either contain a nuclear localization signal (NLS); or a nuclear export signal (NES).
Sequence: DILRDFFELRLK.
Sequence (3-Letter): H-Asp-Ile-Leu-Arg-Asp-Phe-Phe-Glu-Leu-Arg-Leu-Lys-OH.
Hsp Heat shock protein (3 - 13) (Cat# 61900).
This is a fragment of the mycobacterial 65-kDa heat-shock protein (hsp65); residues 3 to 13.
This peptide is an important T cell epitope; immunodominant in the mycobacterium-specific T cell response of II HLA-DR3 positive individuals.
Sequence: KTIAYDEEARR.
Sequence (3-Letter): H-Lys-Thr-Ile-Ala-Tyr-Asp-Glu-Glu-Ala-Arg-Arg-OH.
HCV Core Protein (1-20) (Cat# 61863).
This N-terminal truncated (residues 1 to 20) HCV core protein fragment is able to bind to the HCV internal ribosome entry site (IRES); and as a result influences the level of HCV replication.
Sequence: MSTNPKPQRKTKRNTNRRPQ.
Sequence (3-Letter): H-Met-Ser-Thr-Asn-Pro-Lys-Pro-Gln-Arg-Lys-Thr-Lys-Arg-Asn-Thr-Asn-Arg-Arg-Pro-Gln-OH.
C-terminal Proghrelin Isoform Peptide; mouse (Cat# 61905).
This is a unique C-terminal peptide encoded by the exon 4 - deleted proghrelin variant.
This mouse proghrelin isoform with the complete deletion of exon 4 is potentially generated by alternative splicing of the mouse ghrelin gene.
This C-terminal peptide proghrelin isoform is widely expressed in the multiple mouse tissues.
Sequence: RRQLTSNHGQA.
Sequence (3-Letter): H-Arg-Arg-Gln-Leu-Thr-Ser-Asn-His-Gly-Gln-Ala-OH.
Sialokinin-2 (Cat# 61934).
This invertebrate tachikinin like peptide Sialokinin-2 sharing the F-X-GLM-NH2 vertebrate consensus was purified from the salivary gland of Aedes aegypti (Yellow fever mosquito); and was shown to have potent vasodilatory potency on mammals.
Sequence: DTGDKFYGLM-NH2.
Sequence (3-Letter): H-Asp-Thr-Gly-Asp-Lys-Phe-Tyr-Gly-Leu-Met-NH2.
Cathepsin S substrate.
(Cat# 61859).
This peptide is a cathepsin S substrate fluorescently labeled with AMC.
It can be used to measure cathepsin S activity.
Sequence: Ac-KQKLR-AMC.
Sequence (3-Letter): Ac-Lys-Gln-Lys-Leu-Arg-AMC.
Dok-6 (263-275) (Cat# 61882).
Dok-6 is a novel member of the Dok-4/5 subclass of the p62Dok family that can associate with receptor tyrosine kinase (Ret) and serves as a substrate of the Ret signaling cascade.
Dok-6 expression in vivo overlaps significantly with that of Ret.
Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region.
Sequence: LPRSAYWHHITRQ.
Sequence (3-Letter): H-Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Arg-Gln-OH.
Nuclear Export Signal; NES; Dok-1 (348-359) (Cat# 61886).
This peptide is a functional nuclear export signal (NES) that plays a major role in the localization of Dok1.
Dok1 is an adaptor protein which down-regulates mitogen-activated protein kinase activation; inhibits cell proliferation and transformation; and promotes cell spreading and cell migration.
Dok-1 shuttles between the nucleus and cytoplasm.
The expulsion from the nucleus generally depends upon NES sequence; a short leucine-rich motif that is specifically recognized by the nuclear exporter protein known as chromosomal region maintenance 1 (CRM1).
Sequence: LLKAKLTDPKED.
Sequence (3-Letter): H-Leu-Leu-Lys-Ala-Lys-Leu-Thr-Asp-Pro-Lys-Glu-Asp-OH.
Dok-5 (263-275) (Cat# 61892).
This peptide is a fragment from amino acids 263 to 275 of the Dok-5; a 4/5 subclass of the p62 Dok family.
The expression of Dok-5 has been shown to promote receptor tyrosine kinase (Ret)-mediated neurite outgrowth in vitro.
Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region.
Sequence: LPRSAYWQHITRQ.
Sequence (3-Letter): H-Leu-Pro-Arg-Ser-Ala-Tyr-Trp-Gln-His-Ile-Thr-Arg-Gln-OH.
Dok-4 (263-275) (Cat# 61893).
This peptide is a fragment from amino acids 263 to 275 of Dok-4; the substrate of receptor tyrosine kinase (Ret) and the insulin receptor.
Dok-4 regulates GDNF-mediated neurite outgrowth during neuronal development through the activation of Rap1-ERK1/2 pathway.
In contrast to Dok-1; 2; and 3; Dok-4 and Dok-5 positively regulate RTK signaling pathways; and are highly expressed in non-hematopoietic tissues; in particular the nervous system.
Sequence: LPRSAYWHHITGS.
Sequence (3-Letter): H-Leu-Pro-Arg-Ser-Ala-Tyr-Trp-His-His-Ile-Thr-Gly-Ser-OH.
Dok-4 (130-145) (Cat# 61898).
This peptide is a fragment from amino acids 130 to 145 of Dok-4; the substrate of receptor tyrosine kinase (Ret) and the insulin receptor.
Dok-4 regulates GDNF-mediated neurite outgrowth during neuronal development through the activation of the Rap1-ERK1/2 pathway.
In contrast to Dok-1; 2; and 3; Dok-4 and Dok-5 positively regulate RTK signaling pathways; and are highly expressed in non-hematopoietic tissues; in particular the nervous system.
Sequence: GVQCEQTDRFNVFLLP.
Sequence (3-Letter): H-Gly-Val-Gln-Cys-Glu-Gln-Thr-Asp-Arg-Phe-Asn-Val-Phe-Leu-Leu-Pro-OH.
Alpha-gliadin (57 - 73) (Cat# 61899).
This 17-amino-acid peptide corresponds to the A-gliadin amino acids 57 to 73.
Gliadin-reactive CD4+ T cells are present in the intestinal mucosa of patients with celiac disease (CD); a small intestinal disorder caused by adaptive and innate immune responses triggered by the gluten proteins present in wheat.
Gluten-specific T cell response results in the production of antibodies against tissue transglutaminase (TG); which is shown to deamidate gliadin peptides.
These modified gliadin peptides elicit a strong T-cell response in CD patients.
Sequence: QLQPFPQPELPYPQPQS.
Sequence (3-Letter): H-Gln-Leu-Gln-Pro-Phe-Pro-Gln-Pro-Glu-Leu-Pro-Tyr-Pro-Gln-Pro-Gln-Ser-OH.
Protease-Activated Receptor2(PAR2) Agonist (Cat# 60777).
A PAR-2 activating peptide (PAR-2-AP).
Sequence: SLIGRL-NH2.
Sequence (3-Letter): H-Ser-Leu-Ile-Gly-Arg-Leu-NH2.
