AnaSpec, one of the world's largest providers of custom and catalogue peptides, has introduced 13 new peptides for drug discovery research, listed below
Helodermin (Cat# 61867-05).
Helodermin was originaly isolated from the venom of the lizard Heloderma suspectum.
It is a secretin/VIP-related peptide with sequence similarities to Vasoactive Intestinal Peptide (VIP); Growth Hormone-Releasing Factor (GRF); and peptide histidine-isoleucin (PHI).
Sequence: HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP.
Sequence (3-Letter): H-His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-OH.
Activity-Dependent Neurotrophic Factor; ADNF (Cat# 61929).
Activity-dependent neurotrophic factor (ADNF) is a nine amino acid peptide originally purified from conditioned medium of astrocytes.
ADNF protects neurons from death induced by beta-Amyloid at extremely low concentrations.
Sequence: SALLRSIPA.
Sequence (3-Letter): H-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala-OH.
Beta-Amyloid (10-35) (Cat# 61931).
This is an experimentally defined model peptide for the fibril formation from the core residues of the beta-Amyloid peptides of Alzheimer's disease.
This peptide adopts the structure of an extended parallel beta-sheet at pH 7.4 in high-resolution structural studies.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM.
Sequence (3-Letter): H-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH.
Angiotensin II Receptor; AT2; Amino Terminal Fragment (Cat# 61901).
This peptide is derived from the amino terminus of the rat Angiotensin II; Ang II; AT2 receptor.
Ang II plays a major role in the regulation of blood pressure and fluid; and electrolyte balance.
Sequence: MKDNFSFAATSRNITSS.
Sequence (3-Letter): H-Met-Lys-Asp-Asn-Phe-Ser-Phe-Ala-Ala-Thr-Ser-Arg-Asn-Ile-Thr-Ser-Ser-OH.
Nuclear Export Signal; NES p53 (Cat# 61883).
This peptide is a nuclear export signal (NES) that regulates subcellular localization and nuclear-cytoplasmic shuttling of p53.
Appropriate subcellular localization is crucial for regulating p53 function.
p53 export is mediated by this highly conserved leucine-rich nuclear export signal located in its tetramerization domain.
Mutation of NES residues prevents p53 export and hampers tetramer formation.
Sequence: FRELNEALELKD.
Sequence (3-Letter): H-Phe-Arg-Glu-Leu-Asn-Glu-Ala-Leu-Glu-Leu-Lys-Asp-OH.
Nuclear Export Signal; NES MAPKK (Cat# 61888).
This peptide is a functional nuclear export signal (NES) of mitogen-activated protein kinase kinase (MAPKK); a classical NES peptide.
Sequence: ALQKKLEELELD.
Sequence (3-Letter): H-Ala-Leu-Gln-Lys-Lys-Leu-Glu-Glu-Leu-Glu-Leu-Asp-OH.
Nuclear Export Signal; NES HIV Rev (Cat# 61890).
This peptide is a functional nuclear export signal (NES) of the human immunodeficiency virus Rev protein.
Sequence: LQLPPLERLTLD.
Sequence (3-Letter): H-Leu-Gln-Leu-Pro-Pro-Leu-Glu-Arg-Leu-Thr-Leu-Asp-OH.
Activated Protein C (390-404); human (Cat# 61862).
The peptide region containing residues 390-404 in Activated Protein C (APC) is essential for anticoagulant activity and is available for interaction with antibodies or with other proteins; such as the macromolecular substrates Factors Va or VIIIa.
APC regulates blood coagulation by proteolytic inactivation of the blood coagulation cofactors Va and VIIIa.
Sequence: YGVYTKVSRYLDWIH.
Sequence (3-Letter): H-Tyr-Gly-Val-Tyr-Thr-Lys-Val-Ser-Arg-Tyr-Leu-Asp-Trp-Ile-His-OH.
Translation Initiation Factor 2B; pS13; FAM-labeled (Cat# 61740).
This is a FAM-labeled single phosphorylated amidated peptide corresponding to the translation initiation factor e-subunit of 2B (eIF2B).
It is selective for GSK3 and therefore useful for measuring GSK3 activity in cell extracts that may contain other Ser/Thr kinases.
The references below correspond to the non-labeled peptide.
Sequence: 5-FAM-RRAAEELDSRAG-pS-PQL-NH2.
Sequence (3-Letter): 5-FAM-Arg-Arg-Ala-Ala-Glu-Glu-Leu-Asp-Ser-Arg-Ala-Gly-pSer-Pro-Gln-Leu-NH2.
Doc-6 (130-145) (Cat# 61894).
This peptide is a sequence from fragment 130 to 145 of Doc-6.
Dok-6; a novel member of the Dok-4/5 subclass of the p62Dok family that can associate with receptor tyrosine kinase (Ret) and also serves as a substrate of the Ret signaling cascade.
Dok-6 expression in vivo overlaps significantly with that of Ret.
Dok family members are modular docking proteins consisting of an N-terminal pleckstrin homology (PH) domain; a central PTB domain; and a variable C-terminal region.
A complete sequence of Doc-6 can be found in the reference listed below.
Sequence: GVQREQNERFNVYLMP.
Sequence (3-Letter): H-Gly-Val-Gln-Arg-Glu-Gln-Asn-Glu-Arg-Phe-Asn-Val-Tyr-Leu-Met-Pro-OH.
Pannexin-1 Fragment (4512) (Cat# 61903).
This is a pannexin-1 fragment used in generating anti-pannexin-1 antibody.
Antibody 4512 is directed against this peptide sequence located in the putative first extracellular loop of pannexin 1.
Pannexins represent a recently discovered second family of gap junction proteins in vertebrates.
Pannexin 1also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers.
Pannexin channels could mediate ATP-induced ATP release.
Sequence: VQQKSSLQSESGN.
Sequence (3-Letter): H-Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn-OH.
Pannexin-1 Fragment (4515) (Cat# 61904).
This is a Pannexin-1 fragment used in generating anti-pannexin-1 antibody.
Antibody 4515 was directed against carboxyl-terminal amino acids.
Pannexins represent a recently discovered second family of gap junction proteins in vertebrates.
Pannexin 1; in addition to forming gap junctions in paired oocytes; also forms nonjunctional membrane channels that provide a passageway from the cytoplasm to the extracellular space for molecules in the size range of second messengers.
Pannexin-1 forms a stress-sensitive; ATP-permeable channel.
Sequence: EKNSRQRLLNPS.
Sequence (3-Letter): H-Glu-Lys-Asn-Ser-Arg-Gln-Arg-Leu-Leu-Asn-Pro-Ser-OH.
Invertebrate Tachykinin-I; OctTK-I (Cat# 61933).
This novel invertebrate tachikinin-like peptide (Inv-TK) OctTK-I with C-terminal consensus motif F-X-GLM-NH2 was characterized from salivary gland of Octopus vulgaris.
It displays structural and functional similarities with vertebrate tachykinins.
Sequence: KPPSSSEFIGLM-NH2.
Sequence (3-Letter): H-Lys-Pro-Pro-Ser-Ser-Ser-Glu-Phe-Ile-Gly-Leu-Met-NH2.
